SFRS10 monoclonal antibody (M01), clone 7A1

• Catalog Number: orb2292191
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SFRS10.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7A1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: SFRS10 (NP_004584, 120 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP
• NCBI: NP_004584
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SFRS10 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody (M01), clone 7A1. Lane 1: SFRS10 transfected lysate (33.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SFRS10 monoclonal antibody (M01), clone 7A1 (Cat # orb2292191). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (34.54 KDa).