You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291909 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SF3A2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SF3A2 (NP_009096, 112 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK |
Tested applications | ELISA, IF, WB |
Clone Number | 3B6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_009096 |
Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.29 KDa).