Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SERPINE1 Rabbit Polyclonal Antibody

SKU: orb580070

Description

Rabbit polyclonal antibody to SERPINE1

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SERPINE1
TargetSERPINE1
Protein SequenceSynthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM
Molecular Weight43kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-Plasminogen Activator Inhibitor-1 antibody, anti-Clade E antibody, anti-Endothelial plasminogen activator inhibitor antibody, anti-Nexin antibody, anti-Nexin plasminogen activator inhibitor type 1 antibody, anti-PAI 1 antibody, anti-PAI antibody, anti-PAI-1 antibody, anti-PAI1_HUMAN antibody, anti-PLANH1 antibody, anti-Plasminogen activator inhibitor 1 antibody, anti-Plasminogen activator inhibitor type 1 antibody, anti-Serine (or cysteine) proteinase inhibitor antibody, anti-Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 antibody, anti-Serine proteinase inhibitor clade E member 1 antibody, anti-serpin antibody, anti-Serpin E1 antibody, anti-Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 antibody, anti-Serpin peptidase inhibitor clade E antibody, anti-Serpine 1 antibody, anti-SERPINE1 antibody

Similar Products

  • PAI1 Rabbit Polyclonal Antibody [orb11226]

    ICC,  WB

    Bovine, Canine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • SERPINE1 Rabbit Polyclonal Antibody [orb580069]

    IHC,  WB

    Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PAI1 Rabbit Polyclonal Antibody [orb100547]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SERPINE1 Antibody (Center) [orb1438014]

    FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • SERPINE1 Antibody [orb675801]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SERPINE1 Rabbit Polyclonal Antibody

WB Suggested Anti-SERPINE1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000593

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SERPINE1 Rabbit Polyclonal Antibody (orb580070)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry