SERPINB3 monoclonal antibody (M01), clone 2F5

• Catalog Number: orb2292207
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SERPINB3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F5
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: SERPINB3 (NP_008850, 276 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
• NCBI: NP_008850
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SERPINB3 is approximately 0.3 ng/ml as a capture antibody.

Immunoprecipitation of SERPINB3 transfected lysate using anti-SERPINB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SERPINB3 MaxPab rabbit polyclonal antibody.

Western Blot analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 monoclonal antibody (M01), clone 2F5. Lane 1: SERPINB3 transfected lysate (44.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (38.39 KDa).