You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977835 |
---|---|
Category | Proteins |
Description | Serine racemase/SRR Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. |
Tag | N-6xHis-SUMO |
Purity | 94.00% |
Protein Sequence | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV |
UniProt ID | Q9GZT4 |
MW | 52.6 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Human |
Biological Activity | Serine racemase/SRR Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. |
Expression Region | 1-340 aa |
Storage | -20°C |
Note | For research use only |