You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293620 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant SEPT1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SEPT1 (AAH12161, 1 a.a. ~ 367 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARRLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQRSQAQGEQSDAL |
Tested applications | ELISA, IF, IP, WB |
Clone Number | 1F12 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH12161 |
Detection limit for recombinant GST tagged SEPT1 is 3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SEPT1 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoprecipitation of SEPT1 transfected lysate using anti-SEPT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SEPT1 MaxPab rabbit polyclonal antibody.
Western Blot analysis of SEPT1 expression in transfected 293T cell line by SEPT1 monoclonal antibody (M03), clone 1F12. Lane 1: SEPT1 transfected lysate (42 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (66.11 KDa).