SEPT1 monoclonal antibody (M03), clone 1F12

• Catalog Number: orb2293620
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant SEPT1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SEPT1 (AAH12161, 1 a.a. ~ 367 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARRLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQRSQAQGEQSDAL
• Tested applications: ELISA, IF, IP, WB
• Clone Number: 1F12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH12161

Detection limit for recombinant GST tagged SEPT1 is 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SEPT1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of SEPT1 transfected lysate using anti-SEPT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SEPT1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of SEPT1 expression in transfected 293T cell line by SEPT1 monoclonal antibody (M03), clone 1F12. Lane 1: SEPT1 transfected lysate (42 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (66.11 KDa).