SENP8 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2290674
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human SENP8 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: SENP8 (NP_660205.2, 1 a.a. ~ 212 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
• NCBI: NP_660205.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of SENP8 transfected lysate using anti-SENP8 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SENP8 monoclonal antibody (M06), clone 2E1.

SENP8 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP8 expression in human liver.

Western Blot analysis of SENP8 expression in transfected 293T cell line by SENP8 MaxPab polyclonal antibody. Lane 1: SENP8 transfected lysate(24.1 KDa). Lane 2: Non-transfected lysate.