You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
SELS MaxPab rabbit polyclonal antibody (D01)
Catalog Number: orb2291001
| Catalog Number | orb2291001 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human SELS protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IP, WB |
| Reactivity | Human |
| Immunogen | SELS (NP_060915.2, 1 a.a. ~ 187 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG |
| NCBI | NP_060915.2 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | No additive |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of SELS transfected lysate using anti-SELS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SELS purified MaxPab mouse polyclonal antibody (B02P).
SELS MaxPab rabbit polyclonal antibody. Western Blot analysis of SELS expression in HepG2.
Western Blot analysis of SELS expression in transfected 293T cell line by SELS MaxPab polyclonal antibody. Lane 1: SELS transfected lysate(21 KDa). Lane 2: Non-transfected lysate.
