You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291700 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SEC22L1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Lambda |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SEC22L1 (NP_004883, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY |
Tested applications | ELISA, IF, WB |
Clone Number | 1E1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004883 |
Detection limit for recombinant GST tagged SEC22L1 is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10 ug/ml]
SEC22L1 monoclonal antibody (M01), clone 1E1 Western Blot analysis of SEC22L1 expression in HeLa.
SEC22L1 monoclonal antibody (M01), clone 1E1. Western Blot analysis of SEC22L1 expression in PC-12.
Western Blot detection against Immunogen (37.84 KDa).