SEC22L1 monoclonal antibody (M01), clone 1E1

• Catalog Number: orb2291700
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SEC22L1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Lambda
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SEC22L1 (NP_004883, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY
• Tested applications: ELISA, IF, WB
• Clone Number: 1E1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004883

Detection limit for recombinant GST tagged SEC22L1 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10 ug/ml]

SEC22L1 monoclonal antibody (M01), clone 1E1 Western Blot analysis of SEC22L1 expression in HeLa.

SEC22L1 monoclonal antibody (M01), clone 1E1. Western Blot analysis of SEC22L1 expression in PC-12.

Western Blot detection against Immunogen (37.84 KDa).