You have no items in your shopping cart.
Cart summary
SDF2L1 Protein, Mouse, Recombinant (His & Myc)
Catalog Number: orb1977006
| Catalog Number | orb1977006 |
|---|---|
| Category | Proteins |
| Description | SDF2L1 Protein, Mouse, Recombinant (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 24.4 kDa and the accession number is Q9ESP1. |
| Tag | N-6xHis, C-Myc |
| Purity | 98.00% |
| MW | 24.4 kDa (predicted) |
| UniProt ID | Q9ESP1 |
| Protein Sequence | SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mouse |
| Biological Activity | SDF2L1 Protein, Mouse, Recombinant (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 24.4 kDa and the accession number is Q9ESP1. |
| Expression Region | 29-211 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
