SDCBP monoclonal antibody (M01), clone 2C12

• Catalog Number: orb2292198
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SDCBP.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SDCBP (NP_005616, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Clone Number: 2C12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005616

Detection limit for recombinant GST tagged SDCBP is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SDCBP on HeLa cell. [antibody concentration 35 ug/ml]

Immunoperoxidase of monoclonal antibody to SDCBP on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Immunoprecipitation of SDCBP transfected lysate using anti-SDCBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SDCBP MaxPab rabbit polyclonal antibody.

SDCBP monoclonal antibody (M01), clone 2C12 Western Blot analysis of SDCBP expression in HepG2.

Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP monoclonal antibody (M01), clone 2C12. Lane 1: SDCBP transfected lysate (32.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).