You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
SCYL1BP1 MaxPab mouse polyclonal antibody (B01)
Catalog Number: orb2290716
| Catalog Number | orb2290716 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a full-length human SCYL1BP1 protein. |
| Species/Host | Mouse |
| Clonality | Polyclonal |
| Tested applications | IF, WB |
| Reactivity | Human |
| Immunogen | SCYL1BP1 (AAH64945, 1 a.a. ~ 246 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYAR |
| NCBI | AAH64945 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | No additive |
| Note | For research use only |
| Application notes | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Expiration Date | 12 months from date of receipt. |
Immunofluorescence of purified MaxPab antibody to SCYL1BP1 on HeLa cell. [antibody concentration 10 ug/ml]
SCYL1BP1 MaxPab polyclonal antibody. Western Blot analysis of SCYL1BP1 expression in human colon.
Western Blot analysis of SCYL1BP1 expression in transfected 293T cell line by SCYL1BP1 MaxPab polyclonal antibody. Lane 1: SCYL1BP1 transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.
