SCYL1 monoclonal antibody (M02), clone 2E5

• Catalog Number: orb2290941
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SCYL1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SCYL1 (AAH09967, 373 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP
• Tested applications: ELISA, WB
• Clone Number: 2E5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH09967

Detection limit for recombinant GST tagged SCYL1 is 0.03 ng/ml as a capture antibody.

SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in A-431.

SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in Hela S3 NE.

SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in human ovarian cancer.

SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in NIH/3T3.

SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in PC-12.

Western Blot detection against Immunogen (36.63 KDa).