You have no items in your shopping cart.
Cart summary
Item 1 of 7
Item 1 of 7
SCYL1 monoclonal antibody (M02), clone 2E5
Catalog Number: orb2290941
| Catalog Number | orb2290941 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant SCYL1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 2E5 |
| Tested applications | ELISA, WB |
| Reactivity | Human, Mouse, Rat |
| Isotype | IgG2a Kappa |
| Immunogen | SCYL1 (AAH09967, 373 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP |
| NCBI | AAH09967 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged SCYL1 is 0.03 ng/ml as a capture antibody.
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in A-431.
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in Hela S3 NE.
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in human ovarian cancer.
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in NIH/3T3.
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in PC-12.
Western Blot detection against Immunogen (36.63 KDa).
