SCN8A monoclonal antibody (M04), clone 4G7

• Catalog Number: orb2292206
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SCN8A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G7
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
• NCBI: NP_055006
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SCN8A is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SCN8A on NIH/3T3 cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (36.52 KDa).