SCN4B Antibody

• Catalog Number: orb546367
• Category: Antibodies
• Description: SCN4B Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SCN4B (LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 28 kDa
• UniProt ID: Q8IWT1
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Sodium channel subunit beta-4; SCN4B
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-SCN4B antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of SiHa cells using anti-SCN4B antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of SCN4B using anti-SCN4B antibody.Lane 1:human placenta tissue;2:human U-87MG cell;3:monkey COS-7 cell;4:human U2OS cell;5:human HEK293 cell;6:human SHG-44 cell;7:human K562 cell (negative control);8:human HL-60 cell (negative control).

WB analysis of SCN4B using anti-SCN4B antibody.Lane 1:rat brain tissue;2:rat heart tissue;3:rat spleen tissue;4:rat kidney tissue;5:mouse brain tissue;6:mouse heart tissue;7:mouse spleen tissue;8:mouse kidney tissue;9:mouse Neuro-2a cell.

IHC analysis of SCN4B using anti-SCN4B antibody.SCN4B was detected in paraffin-embedded section of human renal cancer tissue.

IHC analysis of SCN4B using anti-SCN4B antibody.SCN4B was detected in paraffin-embedded section of rat spleen tissue.