SCN11A Antibody

• Catalog Number: orb614135
• Category: Antibodies
• Description: SCN11A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: "Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat Flow Cytometry, 1-3μg/1x106 cells, Human"
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 250 kDa
• UniProt ID: Q9UI33
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Sodium channel protein type 11 subunit alpha; Peri
• Note: For research use only
• Application notes: "Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users." . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis using anti-SCN11A antibody.Lane 1:PC-3 cell, Lane 2:rat brain tissue, Lane 3:rat kidney tissue, Lane 4:rat C6 cell, Lane 5:mouse spleen tissue, Lane 6:mouse brain tissue, Lane 7:mouse kidney tissue.

IHC analysis of SCN11A using anti-SCN11A antibody.

IHC analysis of SCN11A using anti-SCN11A antibody.

Flow Cytometry analysis of U87 cells using anti-SCN11A antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.