Scavenging Receptor SR-BI/SCARB1 Antibody

• Catalog Number: orb308797
• Category: Antibodies
• Description: Scavenging Receptor SR-BI/SCARB1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, RatImmunohistochemistry (Frozen Section), 0.5-1μg/ml, Mouse Immunocytochemistry, 0.5-1μg/ml, Mouse Flow Cytometry, 1-3μg/1x106 cells, Mouse
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 56754 MW
• UniProt ID: Q61009
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Scavenger receptor class B member 1;SRB1;SR-BI;Sca
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of BRL cells using anti-SCARB1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of SCARB1 using anti-SCARB1 antibody.Lane 1:Rat Testis Tissue;2:Mouse Testis Tissue.