You have no items in your shopping cart.
Cart summary
SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His)
Catalog Number: orb1976431
| Catalog Number | orb1976431 |
|---|---|
| Category | Proteins |
| Description | SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 41.7 kDa and the accession number is YP_009725299.1. |
| Tag | N-10xHis |
| Purity | 98.00% |
| MW | 41.7 kDa (predicted) |
| UniProt ID | YP_009725299.1 |
| Protein Sequence | EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK |
| Expression System | E. coli |
| Biological Origin | SARS-CoV-2 |
| Biological Activity | SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 41.7 kDa and the accession number is YP_009725299.1. |
| Expression Region | 746-1060 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
