SALF antibody

Catalog Number: orb573830

Catalog Number	orb573830
Category	Antibodies
Description	Rabbit polyclonal antibody to SALF
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human SALF
Concentration	1.0 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	132kDa
Target	STON1-GTF2A1L
Protein Sequence	Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD
NCBI	NP_758515
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	ALF, SALF, GTF2A1L, GTF2A1LF Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.