You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292212 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SAFB. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SAFB (NP_002958, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 5A11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_002958 |
Detection limit for recombinant GST tagged SAFB is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SAFB on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to SAFB on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
SAFB monoclonal antibody (M04), clone 5A11 Western Blot analysis of SAFB expression in Hela S3 NE.
Western Blot detection against Immunogen (35.64 KDa).