SAA3 Protein, Mouse, Recombinant (His)

• Catalog Number: orb1977018
• Category: Proteins
• Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA3 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.8 kDa and the accession number is P04918.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 13.8 kDa (predicted)
• UniProt ID: P04918
• Protein Sequence: RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
• Expression System: P. pastoris (Yeast)
• Biological Origin: Mouse
• Biological Activity: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA3 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.8 kDa and the accession number is P04918.
• Expression Region: 20-122 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.