You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1979553 |
---|---|
Category | Proteins |
Description | Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707. |
Tag | N-6xHis-B2M |
Purity | 98.00% |
MW | 24.1 kDa (predicted) |
UniProt ID | P19707 |
Protein Sequence | EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG |
Expression System | E. coli |
Biological Origin | Feline |
Biological Activity | Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707. |
Expression Region | 1-90 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |