You have no items in your shopping cart.
Cart summary
SAA1 Protein, Feline, Recombinant (B2M & His)
Catalog Number: orb1979553
| Catalog Number | orb1979553 |
|---|---|
| Category | Proteins |
| Description | Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707. |
| Tag | N-6xHis-B2M |
| Purity | 98.00% |
| MW | 24.1 kDa (predicted) |
| UniProt ID | P19707 |
| Protein Sequence | EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG |
| Expression System | E. coli |
| Biological Origin | Feline |
| Biological Activity | Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707. |
| Expression Region | 1-90 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
