S100B monoclonal antibody (M52), clone 2A10

• Catalog Number: orb2292217
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant S100B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A10
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
• NCBI: NP_006263.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to S100B on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (35.86 KDa).