You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292218 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant S100B. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 1B2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_006263.1 |
Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to S100B on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (35.86 KDa).