S100B monoclonal antibody (M50), clone 1B2

• Catalog Number: orb2292218
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant S100B.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 1B2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006263.1

Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to S100B on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (35.86 KDa).