S100A6 monoclonal antibody (M10), clone 6B5

• Catalog Number: orb2292228
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant S100A6.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6B5
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: S100A6 (AAH01431, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
• NCBI: AAH01431
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged S100A6 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to S100A6 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to S100A6 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 3 ug/ml]

S100A6 monoclonal antibody (M10), clone 6B5 Western Blot analysis of S100A6 expression in HeLa.

Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M10), clone 6B5. Lane 1: S100A6 transfected lysate (10.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.64 KDa).