S100A6 monoclonal antibody (M16), clone 6D1

• Catalog Number: orb2292227
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant S100A6.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6D1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: S100A6 (NP_055439, 18 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEALKG
• NCBI: NP_055439
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged S100A6 is approximately 0.03 ng/ml as a capture antibody.

S100A6 monoclonal antibody (M16), clone 6D1 Western Blot analysis of S100A6 expression in HeLa.

Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M16), clone 6D1. Lane 1: S100A6 transfected lysate (10.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (33.77 KDa).