S100A4 monoclonal antibody (M01), clone 1F12-1G7

• Catalog Number: orb2292229
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant S100A4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
• Tested applications: ELISA, IF, WB
• Clone Number: 1F12-1G7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH16300

Detection limit for recombinant GST tagged S100A4 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to S100A4 on HeLa cell. [antibody concentration 15 ug/ml]

S100A4 monoclonal antibody (M01), clone 1F12-1G7 Western Blot analysis of S100A4 expression in Hela.

S100A4 monoclonal antibody (M01), clone 1F12-1G7. Western Blot analysis of S100A4 expression in Raw 264.7.

Western Blot analysis of S100A4 expression in transfected 293T cell line by S100A4 monoclonal antibody (M01), clone 1F12-1G7. Lane 1: S100A4 transfected lysate (11.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.85 KDa).