You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292229 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant S100A4. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F12-1G7 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Mouse |
Isotype | IgG1 kappa |
Immunogen | S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK |
NCBI | AAH16300 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged S100A4 is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to S100A4 on HeLa cell. [antibody concentration 15 ug/ml]
S100A4 monoclonal antibody (M01), clone 1F12-1G7 Western Blot analysis of S100A4 expression in Hela.
S100A4 monoclonal antibody (M01), clone 1F12-1G7. Western Blot analysis of S100A4 expression in Raw 264.7.
Western Blot analysis of S100A4 expression in transfected 293T cell line by S100A4 monoclonal antibody (M01), clone 1F12-1G7. Lane 1: S100A4 transfected lysate (11.7 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.85 KDa).