You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292219 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant S100A13. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | S100A13 (NP_005970, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK |
Tested applications | ELISA, IF, WB |
Clone Number | 3A7 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005970 |
Detection limit for recombinant GST tagged S100A13 is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to S100A13 on HeLa cell. [antibody concentration 10 ug/ml]
S100A13 monoclonal antibody (M01), clone 3A7 Western Blot analysis of S100A13 expression in MCF-7.
Western Blot analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody (M01), clone 3A7. Lane 1: S100A13 transfected lysate (11.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.52 KDa).