S100A13 monoclonal antibody (M01), clone 3A7

• Catalog Number: orb2292219
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant S100A13.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: S100A13 (NP_005970, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
• Tested applications: ELISA, IF, WB
• Clone Number: 3A7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005970

Detection limit for recombinant GST tagged S100A13 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to S100A13 on HeLa cell. [antibody concentration 10 ug/ml]

S100A13 monoclonal antibody (M01), clone 3A7 Western Blot analysis of S100A13 expression in MCF-7.

Western Blot analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody (M01), clone 3A7. Lane 1: S100A13 transfected lysate (11.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.52 KDa).