S100A12 Antibody

• Catalog Number: orb1536656
• Category: Antibodies
• Description: S100A12 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A12 (NP_005612.1). MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
• Dilution range: IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: S100A12
• Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: S100A12, Calgranulin-C, CGRP, CAAF1, ENRAGE, MRP-6
• Note: For research use only
• Application notes: Further information: The predicted MW is 10kDa, while the observed MW by Western blot was Refer to Figures.
• Expiration Date: 12 months from date of receipt.