You have no items in your shopping cart.
Cart summary
RYR3 Recombinant Protein (Human)
Catalog Number: orb2053940
| Catalog Number | orb2053940 |
|---|---|
| Category | Proteins |
| Description | RYR3 Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 32.5 kDa |
| UniProt ID | Q15413 |
| Protein Sequence | DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV |
| Source | E.coli |
| NCBI | NP_001027 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | brain ryanodine receptor-calcium release channel;b Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human RYR3 protein [orb382969]
Greater than 90% as determined by SDS-PAGE.
32.5 kDa
E.coli
20 μg, 100 μg, 1 mgRYR3 Recombinant Protein (Human) [orb2053941]
Greater than 90% as determined by SDS-PAGE.
32.5 kDa
E.coli
1 mgRYR3 Recombinant Protein (Human) [orb2053942]
Greater than 90% as determined by SDS-PAGE.
32.5 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
