You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295035 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human RUNX3 protein. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | IF, IHC-P, WB |
Reactivity | Human |
Immunogen | RUNX3 (AAH13362.1, 1 a.a. ~ 429 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY |
NCBI | AAH13362.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | No additive |
Note | For research use only |
Application notes | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Expiration Date | 12 months from date of receipt. |
Immunofluorescence of purified MaxPab antibody to RUNX3 on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of purified MaxPab antibody to RUNX3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml].
RUNX3 MaxPab polyclonal antibody. Western Blot analysis of RUNX3 expression in human pancreas.
Western Blot analysis of RUNX3 expression in transfected 293T cell line by RUNX3 MaxPab polyclonal antibody. Lane 1: RUNX3 transfected lysate(47.19 KDa). Lane 2: Non-transfected lysate.