You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb215911 |
---|---|
Category | Antibodies |
Description | RUNX1/AML1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, IHC-Fr, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human RUNX1 (200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By HeatWestern blot, 0.1-0.5μg/ml, Human, Mouse, RatImmunohistochemistry (Frozen Section), 0.5-1μg/ml, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 48737 MW |
UniProt ID | Q01196 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Runt-related transcription factor 1;Acute myeloid Read more... |
Note | For research use only |
Application notes | WB: The detection limit for RUNX1 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of RUNX1 using anti-RUNX1 antibody.Lane 1:human HL-60 cell;2:rat thymus tissue;3:mouse thymus tissue.
IHC analysis of RUNX1 using anti-RUNX1 antibody.RUNX1 was detected in paraffin-embedded section of rat thymus tissue.
IHC analysis of RUNX2 using anti-RUNX2 antibody.RUNX2 was detected in paraffin-embedded section of human mammary cancer tissue.
IHC analysis of RUNX3 using anti-RUNX3 antibody.RUNX3 was detected in paraffin-embedded section of mouse intestine tissue.
IHC analysis of RUNX3 using anti-RUNX3 antibody.RUNX3 was detected in paraffin-embedded section of rat intestine tissue.
IHC analysis of RUNX3 using anti-RUNX3 antibody.RUNX3 was detected in frozen section of rat spleen tissue.
ICC, IHC-Fr, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, ICC, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating