RUNX1 monoclonal antibody (M05), clone 4E7

• Catalog Number: orb2295046
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RUNX1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E7
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse
• Isotype: IgG2b Kappa
• Immunogen: RUNX1 (NP_001001890.1, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
• NCBI: NP_001001890.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RUNX1 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml].

RUNX1 monoclonal antibody (M05), clone 4E7. Western Blot analysis of RUNX1 expression in K-562.

Western Blot detection against Immunogen (36.85 KDa).