RUNX1 monoclonal antibody (M02), clone 3A1

• Catalog Number: orb2295048
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RUNX1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A1
• Tested applications: ELISA, IF, IHC-P, PLA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: RUNX1 (NP_001001890.1, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
• NCBI: NP_001001890.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CDK6 and RUNX1. HeLa cells were stained with anti-CDK6 rabbit purified polyclonal 1:1200 and anti-RUNX1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.85 KDa).