You have no items in your shopping cart.
Cart summary
Item 1 of 1
RSRP1 Rabbit Polyclonal Antibody
Catalog Number: orb325393
| Catalog Number | orb325393 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to C1orf63 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human C1orf63 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 33kDa |
| Target | RSRP1 |
| UniProt ID | Q9BUV0 |
| Protein Sequence | Synthetic peptide located within the following region: PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKKSPYGLWIPI |
| NCBI | NP_064713 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti DJ465N24.2.1 antibody, anti NPD014 antibody, Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-C1orf63 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate, C1orf63 is supported by BioGPS gene expression data to be expressed in HepG2.
