RSPH9 Rabbit Polyclonal Antibody

SKU: orb326648

Description

RSPH9 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RSPH9. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human RSPH9. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RSPH9
• Target: RSPH9
• Protein Sequence: Synthetic peptide located within the following region: VKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQID
• Molecular Weight: 30kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C6orf206 antibody, anti CILD12 antibody, anti FLJ30845 antibody, anti MRPS18AL1 antibody

Quick Database Links

Gene Symbol

RSPH9

UniProt

Q9H1X1

RefSeq (Protein):NP_689945