RRM2 monoclonal antibody (M01), clone 1E1

• Catalog Number: orb2292233
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RRM2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E1
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
• NCBI: NP_001025
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RRM2 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RRM2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to RRM2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]

Immunoprecipitation of RRM2 transfected lysate using anti-RRM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RRM2 MaxPab rabbit polyclonal antibody.

RRM2 monoclonal antibody (M01), clone 1E1. Western Blot analysis of RRM2 expression in HepG2.

Western Blot detection against Immunogen (37.84 KDa).