RRAS monoclonal antibody (M01), clone 2E12

• Catalog Number: orb2292234
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RRAS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E12
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: RRAS (AAH16286, 109 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL
• NCBI: AAH16286
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RRAS is approximately 0.3 ng/ml as a capture antibody.

Immunoprecipitation of RRAS transfected lysate using anti-RRAS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RRAS MaxPab rabbit polyclonal antibody.

RRAS monoclonal antibody (M01), clone 2E12 Western Blot analysis of RRAS expression in HeLa.

Western Blot detection against Immunogen (37.73 KDa).