You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292238 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant RPS7. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 3G4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001002 |
Detection limit for recombinant GST tagged RPS7 is approximately 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to RPS7 on HeLa cell. [antibody concentration 20 ug/ml]
Immunoperoxidase of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
RPS7 monoclonal antibody (M03), clone 3G4 Western Blot analysis of RPS7 expression in HeLa.
RPS7 monoclonal antibody (M03), clone 3G4. Western Blot analysis of RPS7 expression in NIH/3T3.
RPS7 monoclonal antibody (M03), clone 3G4. Western Blot analysis of RPS7 expression in PC-12.
RPS7 monoclonal antibody (M03), clone 3G4. Western Blot analysis of RPS7 expression in Raw 264.7.
Western Blot detection against Immunogen (36.74 KDa).