RPS6 Antibody

• Catalog Number: orb19214
• Category: Antibodies
• Description: RPS6 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 28681 MW
• UniProt ID: P62753
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: 40S ribosomal protein S6;Phosphoprotein NP33;RPS6;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of RPS6 using anti-RPS6 antibody.Lane 1:rat testis tissue;2:mouse testis tissue;3:MCF-7 cell;4:A549 cell.

IHC analysis of RPS6 using anti-RPS6 antibody.RPS6 was detected in paraffin-embedded section of rat brain tissues.

IHC analysis of RPS6 using anti-RPS6 antibody.RPS6 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of RPS6 using anti-RPS6 antibody.RPS6 was detected in paraffin-embedded section of human lung cancer tissues.

IHC analysis of RPS6 using anti-RPS6 antibody.RPS6 was detected in paraffin-embedded section of rat kidney tissues.