RPS27L Rabbit Polyclonal Antibody

• Catalog Number: orb583308
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPS27L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS27L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 9kDa
• Target: RPS27L
• UniProt ID: Q71UM5
• Protein Sequence: Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA
• NCBI: NP_057004
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): HepG2 cell lysate (HG), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RPS27L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate. RPS27L is supported by BioGPS gene expression data to be expressed in MCF7.