RPL9 monoclonal antibody (M01), clone 2F11

• Catalog Number: orb2292252
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RPL9.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F11
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: RPL9 (NP_000652, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQAD
• NCBI: NP_000652
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RPL9 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RPL9 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to RPL9 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1 ~ 10 ug/ml]

RPL9 monoclonal antibody (M01), clone 2F11 Western Blot analysis of RPL9 expression in HeLa.

Western Blot detection against Immunogen (36.63 KDa).