RPA70 RPA1 Antibody (monoclonal, 11H4)

• Catalog Number: orb507562
• Category: Antibodies
• Description: RPA70 RPA1 Antibody (monoclonal, 11H4)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 11H4
• Tested applications: FC, IF, IHC, WB
• Reactivity: Human, Monkey, Mouse
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 12 kDa
• UniProt ID: P27694
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Replication protein A 70 kDa DNA-binding subunit;
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-RPA70 antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of RPA70 using anti-RPA70 antibody.Lane 1:HELA cell; 2:MCF-7 cell; 3:K562 cell; 4:COS-7 cell; 5:Caco-2 cell; 6:A549 cell; 7:HEPG2 cell; 8:PC-3 cell; 9:HEPA1-6 cell.

IF analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in immunocytochemical section of A549 cells.

IHC analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in paraffin-embedded section of human lung cancer tissue.