RPA3 monoclonal antibody (M01), clone 1F4

• Catalog Number: orb2292254
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RPA3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F4
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 lambda
• Immunogen: RPA3 (AAH05264, 12 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
• NCBI: AAH05264
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to RPA3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]

RPA3 monoclonal antibody (M01), clone 1F4 Western Blot analysis of RPA3 expression in HL-60.

Western Blot analysis of RPA3 expression in transfected 293T cell line by RPA3 monoclonal antibody (M01), clone 1F4. Lane 1: RPA3 transfected lysate (13.6 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RPA3 over-expressed 293 cell line, cotransfected with RPA3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RPA3 monoclonal antibody (M01), clone 1F4 (Cat # orb2292254). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.73 KDa).