ROMK/Kir1.1 Antibody (Phospho-Ser44/25)

• Catalog Number: orb2240526
• Category: Antibodies
• Description: ROMK/Kir1.1 Antibody (Phospho-Ser44/25)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, IHC, IHC-P
• Immunogen: The antiserum was produced against synthesized peptide derived from human ROMK/Kir1.1 around the phosphorylation site of Ser44/25.
• Conjugation: Unconjugated
• MW: 44 kDa
• UniProt ID: P48048
• Protein Sequence: Synthetic peptide located within the following region: TLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
• Storage: -20°C
• Alternative names: ATP-regulated potassium channel ROM-K;ATP-sensitiv
• Note: For research use only
• Application notes: Application Info: IHC: 1:50~1:100IF: 1:100~1:500ELISA: 1:5000
• Expiration Date: 12 months from date of receipt.