You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291711 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ROCK2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1E12 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | ROCK2 (NP_004841, 1279 a.a. ~ 1388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS |
NCBI | NP_004841 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 30 ug/ml]
Immunoperoxidase of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]
ROCK2 monoclonal antibody (M02), clone 1E12 Western Blot analysis of ROCK2 expression in Hela S3 NE.
Western Blot detection against Immunogen (37.84 KDa).