RNPS1 monoclonal antibody (M05), clone 7G8

• Catalog Number: orb2291484
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RNPS1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7G8
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
• NCBI: NP_006702
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in 293.

RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in HeLa.

RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in human kidney.

RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in PC-12.

RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in rat testis.

RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in Raw 264.7.

Western Blot detection against Immunogen (34.76 KDa).