RNF130 Rabbit Polyclonal Antibody

• Catalog Number: orb574440
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNF130
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF130
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: RNF130
• UniProt ID: Q86XS8
• Protein Sequence: Synthetic peptide located within the following region: QEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQT
• NCBI: NP_060904
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GP, G1RP, G1RZFP, GOLIATH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Human Lung Tumor (T-LU), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 3 ug/ml.

WB Suggested Anti-RNF130 Antibody Titration: 2.5 ug/ml, Positive Control: Human Thymus.