RNF12 monoclonal antibody (M01), clone 1G10

• Catalog Number: orb2291163
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF12.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G10
• Tested applications: ELISA, IP, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
• NCBI: NP_057204
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RNF12 is approximately 0.03 ng/ml as a capture antibody.

Immunoprecipitation of RNF12 transfected lysate using anti-RNF12 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF12 MaxPab rabbit polyclonal antibody.

RNF12 monoclonal antibody (M01), clone 1G10. Western Blot analysis of RNF12 expression in Hela S3 NE.

Western Blot analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody (M01), clone 1G10. Lane 1: RNF12 transfected lysate (Predicted MW: 68.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (34.87 KDa).