RNF111 monoclonal antibody (M05), clone 1C4

• Catalog Number: orb2291079
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF111.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C4
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: RNF111 (NP_060080, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNC
• NCBI: NP_060080
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RNF111 is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RNF111 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody (M05), clone 1C4. Lane 1: RNF111 transfected lysate(107.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF111 monoclonal antibody (M05), clone 1C4 (Cat # orb2291079). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.62 KDa).